PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100119820081
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 303aa    MW: 33681.8 Da    PI: 8.6021
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100119820081genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.97.5e-3196150155
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   +prlrWt +LH++Fv+av++LGG++kAtPk+il lm+v+gLtl+h+kSHLQk+Rl
  Ote100119820081|100119820081  96 RPRLRWTAKLHDQFVKAVDELGGANKATPKAILSLMDVQGLTLYHLKSHLQKFRL 150
                                   59****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.23E-1594151IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.4E-2895150IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-2297151IPR006447Myb domain, plants
PfamPF002492.0E-698148IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MVACTTKRIY IHIHISPHLL LTLQPVIFLS ISHDCDKKRA ARWFXXXXXX XXXXGGAAAA  60
GQPHGREFAF GGFPENERRR REAEVDSDMF QLSYPRPRLR WTAKLHDQFV KAVDELGGAN  120
KATPKAILSL MDVQGLTLYH LKSHLQKFRL GKTGRRLWRK ELVAANYCRR RDERLPALNM  180
EAQPPSISTA FDMNRATALV AETYDDSAVK LEEFGGVKPA LLPLFPPCGR SYSPEWSELL  240
DGGGKRAAAL RPVENAPADD DYLSSLGYSS SEFALTKSFF EEVASFSGHA LAADGDVFGH  300
GSS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082882.12e-77PREDICTED: myb family transcription factor APL-like isoform X2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1791044